SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123965546|ref|YP_001010627.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965546|ref|YP_001010627.1|
Domain Number 1 Region: 6-191
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 7.46e-35
Family Phosphoglucomutase, first 3 domains 0.0036
Further Details:      
 
Domain Number 2 Region: 260-395
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 2.43e-27
Family Phosphoglucomutase, first 3 domains 0.0024
Further Details:      
 
Domain Number 3 Region: 162-274
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.81e-24
Family Phosphoglucomutase, first 3 domains 0.0019
Further Details:      
 
Domain Number 4 Region: 380-482
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 8.24e-19
Family Phosphoglucomutase, C-terminal domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123965546|ref|YP_001010627.1|
Sequence length 486
Comment phosphotransferase superclass [Prochlorococcus marinus str. MIT 9515]
Sequence
MSENELDKIKFGTDGWRGIIGFDFNLSNLSRVVVASCQELDYQYFDETKSKKILIGYDRR
FMASEFANEIASYVKGCGFEPVLSHTYVPTPACSLYAKHNMFLGCLVITASHNPYNWLGL
KIKSFKGCSVDESFTKEVEKRLLLENSIERLEGPYDKVDIKKFHLDQIKSNFNIDFIVNN
LKKMNLHIFVDSMHGSAANCISQIFDSYDSNIFTEIRANYDPLFGGNPPEPLLKYLENLS
EILITNSKKGIKTLGIIFDGDGDRIAVIDEKGRFCSTQVLLPFFISYLGEKNKNLFPVLK
TVSGSDIIGNIAKNQNREVVELPVGFKYIAKKMINEEIFIGGEESGGVGFGDFMPERDAL
YAAMVLLNGIAEKSKYLCETLDEIQQKFGPSFYRRIDIKFPNQSEKEIFKKFINNNIPSE
ICGHKIISISHVDGIKLRLDNNFWLLFRFSGTEPLLRLYCEATSEYDLNEVLQWSQKFIN
RVKQNQ
Download sequence
Identical sequences A2BUQ9
167542.P9515_03111 WP_011819629.1.83733 gi|123965546|ref|YP_001010627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]