SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123965691|ref|YP_001010772.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965691|ref|YP_001010772.1|
Domain Number 1 Region: 12-208
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.58e-60
Family "Hypothetical" protein ybl036c 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123965691|ref|YP_001010772.1|
Sequence length 212
Comment TIM-barrel fold family protein [Prochlorococcus marinus str. MIT 9515]
Sequence
MEISNYLQIKKELPLNVNLLAVSKGFGSQDIKIINDKGQNDFGESRFQEAIEKKLLLKDF
KDIKWHFIGRIQSNKIRKIVQNFDYIHSVDSYEKLLKISNIAFEEHKNPLIMLQVKLMDD
PSKGGFNPKDLLGKWDEIKQLKSIKIKGLMTINPKGLNSTQNIKLFKECRNLANSLKLHD
CSMGMSQDWKEAVEAGSTWLRLGSIIFGNRSY
Download sequence
Identical sequences A2BV54
gi|123965691|ref|YP_001010772.1| 167542.P9515_04561 WP_011819773.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]