SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123965790|ref|YP_001010871.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965790|ref|YP_001010871.1|
Domain Number 1 Region: 4-94
Classification Level Classification E-value
Superfamily PCD-like 7.98e-31
Family PCD-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123965790|ref|YP_001010871.1|
Sequence length 96
Comment pterin-4-alpha-carbinolamine dehydratase [Prochlorococcus marinus str. MIT 9515]
Sequence
MKPHLLQNEELKELIAKIPGWEIISNHLEREFNFGDFIEAFSFMTKIALICEKYNHHPNW
ENVYSKVIIKLSTHDLGGITNLDQKIASEINEIFEK
Download sequence
Identical sequences A2BVF3
WP_011819871.1.83733 167542.P9515_05551 gi|123965790|ref|YP_001010871.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]