SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123965825|ref|YP_001010906.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965825|ref|YP_001010906.1|
Domain Number 1 Region: 386-582
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.47e-63
Family Pyruvate oxidase and decarboxylase PP module 0.000021
Further Details:      
 
Domain Number 2 Region: 210-380
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.73e-63
Family Pyruvate oxidase and decarboxylase, middle domain 0.0000311
Further Details:      
 
Domain Number 3 Region: 17-197
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.17e-62
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123965825|ref|YP_001010906.1|
Sequence length 587
Comment acetolactate synthase 3 catalytic subunit [Prochlorococcus marinus str. MIT 9515]
Sequence
MTLTSPPLSKGDSEKKYPKWITGAEALMDSLRIHGVRVIFGYPGGAILPIYDAVYKAESD
GWLKHYMVRHEQGGSHAADGYARATGEVGVCFGTSGPGATNLVTGIATAQMDSVPLVVVT
GQVPRPAIGTDAFQETDIFGITLPIVKHSWVIRDPSDIAKVVSEAFFIASSGRPGPVLID
IPKDVGQEFFNYERILPGEIIPKGFKRNGEINDNDIDKAIELIKQSAKPLLYVGGGAISS
GAHKEVEILAKNFQIPVTTTLMGKGAFDERDDLSVGMLGMHGTAYANFAVTECDLLITVG
ARFDDRVTGKLDTFAPSAKVIHIDIDPAEVNKNRRVDVAIVSDVAVALSKINEKSLSKNT
SCNTRNWLEKINSWKNKHPLFIPPEEGEIYPQEVLLKVRDLSPEAFITTDVGQHQMWAAQ
YLRNAPRRWISSAGLGTMGFGLPAAMGVKAALPTSEVICIAGDASVLMNIQELGTLSQYG
LKIKLVIINNRWQGMVRQWQESFYHERYSSSDMSCGEPDFVKLAESFGVKGFLISERKQL
HNEFKSALDFDGPALINVRVRRGENCYPMVPPGKSNAQMVGYVNCKN
Download sequence
Identical sequences A2BVI8
WP_011819906.1.83733 167542.P9515_05901 gi|123965825|ref|YP_001010906.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]