SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123965847|ref|YP_001010928.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965847|ref|YP_001010928.1|
Domain Number 1 Region: 4-189
Classification Level Classification E-value
Superfamily ITPase-like 9.16e-49
Family ITPase (Ham1) 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123965847|ref|YP_001010928.1|
Sequence length 194
Comment HAM1 family protein [Prochlorococcus marinus str. MIT 9515]
Sequence
MNFPALTIASGNPKKVSEIFEMLDVLSLEVKKQPEYLNVEETGKTYFENAFLKAKAAALE
TKTWALADDSGLEVDYLDGRPGIYSARYAKSKNEKISKLLRELSDIPYRSAKFISCMVLC
DPKGNLVKDTTGICWGEILKEPKYPNGEFESIFWIKEANCVYGELSHSQLIKLGSRGKAA
KNISPFLKKEFGII
Download sequence
Identical sequences A2BVL0
WP_011819928.1.83733 gi|123965847|ref|YP_001010928.1| 167542.P9515_06121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]