SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123965884|ref|YP_001010965.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965884|ref|YP_001010965.1|
Domain Number 1 Region: 180-640
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.01e-121
Family Amylase, catalytic domain 0.00000000398
Further Details:      
 
Domain Number 2 Region: 647-750
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 8.27e-34
Family alpha-Amylases, C-terminal beta-sheet domain 0.00052
Further Details:      
 
Domain Number 3 Region: 20-115
Classification Level Classification E-value
Superfamily E set domains 0.00000000000143
Family E-set domains of sugar-utilizing enzymes 0.043
Further Details:      
 
Domain Number 4 Region: 136-194
Classification Level Classification E-value
Superfamily E set domains 0.0000000532
Family E-set domains of sugar-utilizing enzymes 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123965884|ref|YP_001010965.1|
Sequence length 754
Comment glycogen branching enzyme [Prochlorococcus marinus str. MIT 9515]
Sequence
MKETIQTDWIKSEAFNLENCCNDNPLNILGPHFFKGKWVTRVWMPEADEVNITFKDKTYK
TTTPNHKWMFEAILHEDPKNNYQINVLRGGVSHSQQDPWAFKDEWMGEVDRHLFAEGNHH
HIWKKMGAHISEDINQKGVMFCIWAPNAKSISIIGDINSWDGRHHPMQKRLGGVWELFMP
ILKEGDVYKYEIRTQQGHIYEKADPYGFLHEVRPQNGSIISKLNNFNWEDSSWITSRDSS
SQINKPISVYEMHLGSWMHDSTDNKYIEKNGNPRHPVPAADLKPGTRFLTYPELTEKLIP
YVKERGFTHIELMPISEHPFDGSWGYQVTGWYAPTSRYGTPNEFKEFINKCHAEGIGVIL
DWVPGHFPKDKHGLAFFDGCHLYEHGDPRIGEHKEWGTLIFNYSRNEVRNFLVANLIYWF
EEFHIDGIRVDAVASMLYRDYLRPEGEWIPNENGGNENLEAVKFLQQANHVLFQHFPGAL
SIAEESTTWPMVTEPTNVGGLGFNLKWNMGWMHDMLDYFEIDPWFRQFHQNSVTFSITYN
YTENFMLALSHDEVVHGKSHLLHKMPGDDWKKFANTRALLTYMWTHPGKKTIFMGMEFGQ
RQEWNVWDDLQWELLEYEPHKGIRNLIDDLNKLYKNEPSLWKNDFDPYGFQWIDCDDTSN
SVISFMRRENESNEWLVVIANFTPNFHESYKIGVPLEGYYKEIFNSDGSKYGGSNKGNMG
GKDTLKYNIHNYENALEIALPPLSVSIFKHQLKK
Download sequence
Identical sequences A2BVP7
gi|123965884|ref|YP_001010965.1| 167542.P9515_06491 WP_011819963.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]