SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123965991|ref|YP_001011072.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123965991|ref|YP_001011072.1|
Domain Number 1 Region: 111-309
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.55e-49
Family BC ATP-binding domain-like 0.00034
Further Details:      
 
Domain Number 2 Region: 13-103
Classification Level Classification E-value
Superfamily PreATP-grasp domain 0.00000000000000374
Family BC N-terminal domain-like 0.017
Further Details:      
 
Domain Number 3 Region: 315-377
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.0000000000126
Family BC C-terminal domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123965991|ref|YP_001011072.1|
Sequence length 396
Comment phosphoribosylaminoimidazole carboxylase ATPase subunit [Prochlorococcus marinus str. MIT 9515]
Sequence
MTQKRNIKNISKNYSLGIIGGGQLALMLTEAANKRGIKVCVQTKSSNDPAGSKADCVIEA
DPLKIKGNKDLIKKCEKIIFENEWIRIEKLNLIESNNIFVPSLQSIQPLVDRISQKKLIE
KMGLPSPRWISIKDFKILEHKEIEDWNFPLMVKSLKGGYDGKGNKKINNKEDLNSFLVGA
ESDDWLIEEWIDYKKELALVGSRDFDGKIRLFPIVETFQKNNVCDWVLSPAEINYDLKTF
VINIFSSIVNELNYVGVMGIEFFYGDKGLLINEIAPRTHNSAHFSIEACTSSQFDQYICI
SSGAKPPDINLNSHGSLMINLLGLKKDFPLSIEKRIEFLTQIKGSNLHWYGKSKESVGRK
MGHITFLLNENNYLKRNEKSREILNKVREIWPSPNE
Download sequence
Identical sequences A2BW04
gi|123965991|ref|YP_001011072.1| WP_011820070.1.83733 167542.P9515_07561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]