SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966041|ref|YP_001011122.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966041|ref|YP_001011122.1|
Domain Number 1 Region: 48-144
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 6.67e-26
Family Pentapeptide repeats 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123966041|ref|YP_001011122.1|
Sequence length 170
Comment hypothetical protein P9515_08061 [Prochlorococcus marinus str. MIT 9515]
Sequence
MIKSISLPSLKNALLTIFFIGILFFNFVNSAWAKRPPEIRNQQDLDLEQDMHGQDLSGNE
FVKFNLNGFDFSQSNLEGAVFNNSKLQNATLNGANLTDALAYATDFTDADLSDVNFTNAL
LMESNFEGAKIDGADFTNAVLSRIQQKELCAIANGTNSSTGESTEYSLGC
Download sequence
Identical sequences A2BW54
gi|123966041|ref|YP_001011122.1| 167542.P9515_08061 WP_011820120.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]