SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966050|ref|YP_001011131.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966050|ref|YP_001011131.1|
Domain Number 1 Region: 1-158
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase catalytic, N-terminal domain 3.79e-42
Family Glutamyl tRNA-reductase catalytic, N-terminal domain 0.00071
Further Details:      
 
Domain Number 2 Region: 327-429
Classification Level Classification E-value
Superfamily Glutamyl tRNA-reductase dimerization domain 1.57e-26
Family Glutamyl tRNA-reductase dimerization domain 0.0068
Further Details:      
 
Domain Number 3 Region: 161-323
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.8e-21
Family Aminoacid dehydrogenase-like, C-terminal domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123966050|ref|YP_001011131.1|
Sequence length 435
Comment glutamyl-tRNA reductase [Prochlorococcus marinus str. MIT 9515]
Sequence
MQIVVVGLSHRTAPVEVREKLSIPDQAISESLKSLRAYSDILEVSILSTCNRLEIYGLVK
DKNIGISSIKEFLSDYSQVNCEVLTPHLFDFRQEEAVLHLMKVSAGLDSLVLGEGQILSQ
VKKMMRLGQENQSTGPILNRLLSQSVSAGKKVRAETNLGTGAVSISSAAVELAQLKIGQD
NGIDGLVSLKGEKVLVVGAGRMSRLLITHLKSKGCNKLTLLNRNIDRAINLSGDFPDIEI
ICKGLDELDKSITLSSLVFTSTASEKPFIDLERIKNISLNNKLKFIDIGVPRNISNDVKQ
HDLIEAFDVDDLEEVVSRNQEFRQKIAKEAESLVKEERIIFLEWWASLEAVPVINKLRSD
LELIRKEELQKALSRMGPDFSARERKVVEALTKGIINKILHTPVTKLRSPQSREERQASL
KIVEKLFSLMDDEQK
Download sequence
Identical sequences A2BW63
167542.P9515_08151 WP_011820129.1.83733 gi|123966050|ref|YP_001011131.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]