SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|123966057|ref|YP_001011138.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966057|ref|YP_001011138.1|
Domain Number 1 Region: 91-232
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 3.14e-31
Family VanY-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123966057|ref|YP_001011138.1|
Sequence length 243
Comment carboxypeptidase [Prochlorococcus marinus str. MIT 9515]
Sequence
MDRKEELKESFDIPVAERKYTNEVNPKYKIYIFLVIPVLLLLFSIAGLRLNKNLNQSRLI
NINTKNTNNFDDSILGHLPYKEISKEKLVVIEPNIEVHIDMSESLLKMKNDAMKDGIYLV
FLSGYRSINLQKDIFYSLKSMRNQIAAERARVSAPPGYSEHSTGFAIDIGDADKRETDFE
VEFENTNAFRWLKNNAAKYHFKLSFNKNNKNVDYEPWHWRYEGSIEALKVFEASNRNLKK
QLN
Download sequence
Identical sequences A2BW70
gi|123966057|ref|YP_001011138.1| 167542.P9515_08221 WP_011820136.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]