SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966060|ref|YP_001011141.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966060|ref|YP_001011141.1|
Domain Number 1 Region: 155-376
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.85e-44
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0000208
Further Details:      
 
Domain Number 2 Region: 21-154
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 5.4e-31
Family Duplicated SiR/NiR-like domains 1 and 3 0.0047
Further Details:      
 
Domain Number 3 Region: 458-582
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.09e-26
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00011
Further Details:      
 
Domain Number 4 Region: 378-451
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.18e-16
Family Duplicated SiR/NiR-like domains 1 and 3 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123966060|ref|YP_001011141.1|
Sequence length 596
Comment sulfite reductase subunit beta [Prochlorococcus marinus str. MIT 9515]
Sequence
MIKVEKVKKKKKIEKQETVCLANGLEVSKFENFKKGSEFLKEPLASELKNESDHFTNDAV
QLLKFHGSYQQDNRENRKPGKGKDWQMMLRLRSPGGEIPGKLFLSLDELSDKLGNGTLRI
TTRQAFQMHGIRKDNLKKVIKSIVNSMGSTLAACGDINRNVMAPAAPFETSEYITARTLA
VKVADLLTPVAGQGTFLELWADGDLEYTIKPDKEIEENRKLQFKENVFSGSKKEPLYGST
YLPRKFKCAVTVPGDNSVDLLTNDIGIVAFTSKEGEFEGCNFYIGGGMGRTHNNEETFAR
IADPLGYVDKKDIYELIQSIVAIQRDYGDRKSRKNSRMKYLLHRKGIKWFKKILLDKYFR
KEIKPLRKEPENKLIDYLGWHKQNEDYYFVGLPLLSGRLYGKKKSLIRNIVKENNLDLRL
TPNQDILLCNIPKKNKREIQKALKSIGYDNLHDINEIQRHALACPALPLCGLAMTEAERI
LPEVLSRIENLLNDMNIEKTILFRMTGCPNGCTRPYMAELALVGSGQNKYQLWLGGSKNL
QRLARPYLQRMDLDDLEKTIKPLLEFWKKSNPEKDFGDFINNETDSSINNLLIEFD
Download sequence
Identical sequences A2BW73
gi|123966060|ref|YP_001011141.1| 167542.P9515_08251 WP_011820139.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]