SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966070|ref|YP_001011151.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|123966070|ref|YP_001011151.1|
Domain Number - Region: 123-231
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 0.0262
Family Helical scaffold and wing domains of SecA 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123966070|ref|YP_001011151.1|
Sequence length 241
Comment phycocyanobilin:ferredoxin oxidoreductase [Prochlorococcus marinus str. MIT 9515]
Sequence
MLSESLTKTKLIDPLILTLLQNIRGHRSNLENLKSIKIDPKLSNIISDKEGKELYIENEF
HKAKGFRKLHIEVAEFSRRLKILHCVFFPDPHYDIPIFGMDLVKVNEVVSAAIVDLSPSS
KNQNLKYDNLLSTIDKSVFESEREIPGWGDIFSQNVFFASLKNESEKSAFCKIVDHYLLV
LIKLSKSSILDHDQEIIQERIDFQKNYCRQQMKNEKTSLVLLKYFDKKWVDEYIKKVLFD
F
Download sequence
Identical sequences A2BW83
gi|123966070|ref|YP_001011151.1| WP_011820149.1.83733 167542.P9515_08371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]