SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966074|ref|YP_001011155.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966074|ref|YP_001011155.1|
Domain Number 1 Region: 177-418
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.94e-69
Family Extended AAA-ATPase domain 0.0000000432
Further Details:      
 
Domain Number 2 Region: 432-629
Classification Level Classification E-value
Superfamily FtsH protease domain-like 2.09e-66
Family FtsH protease domain-like 0.00000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123966074|ref|YP_001011155.1|
Sequence length 637
Comment FtsH ATP-dependent protease-like protein [Prochlorococcus marinus str. MIT 9515]
Sequence
MNQKLKTIILWALPIILVIALSYQFLSTSNVDNLKSNGTTIAPKNTAVARVSYGRFLDYI
KSGRVTSVDIFDGGRNAVVETVDSDLDNKVQRLRVDLPGLTPELINNLKNEGISFDVHPV
KATPPALGILGNLLFPAILIGGLILLARRSNGMPGGPGQAMQFGKSKARFAMDANTGVVF
DDVAGVNEAKEDLEEVVTFLKKPEKFTSVGARIPKGVLLVGPPGTGKTLLAKAIAGEAGV
PFFSLAGSEFVEMFVGVGASRVRDLFKKAKENSPCLIFIDEIDAVGRQRGAGIGGGNDER
EQTLNQLLTEMDGFEGNSGIIIIAATNRPDVLDSALMRPGRFDRQVTVDAPDIKGRLSIL
EVHSKNKTLQEDLTLESIARRTPGFTGADLANLLNEAAILTARRRKKSISILEIDDSVDR
IVAGMEGSPLTDGRSKRLIAYHEVGHAIIGSLVKAHDPVQKVTVIPRGQAKGLTWFTPDD
DQSLISRANLKARIMGALGGRAAEDVVFGRGEITTGAGGDFQQVAQMARQMVTRFGMSDL
GPIALESGNQEVFVGRDLMTRSEVSDSISKQIDESVRVMVKDCYKETYSIISKNREAMDK
LVDLLIERETLDGEEFVKILSEFTTVPEKERTPQLLN
Download sequence
Identical sequences A2BW87
WP_011820153.1.83733 gi|123966074|ref|YP_001011155.1| 167542.P9515_08411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]