SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966133|ref|YP_001011214.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966133|ref|YP_001011214.1|
Domain Number 1 Region: 128-401
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.13e-103
Family BC ATP-binding domain-like 0.0000000154
Further Details:      
 
Domain Number 2 Region: 695-961
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 1.63e-95
Family BC ATP-binding domain-like 0.000000295
Further Details:      
 
Domain Number 3 Region: 396-550
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 1.24e-48
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.00012
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.58e-47
Family BC N-terminal domain-like 0.00000444
Further Details:      
 
Domain Number 5 Region: 571-697
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.12e-42
Family BC N-terminal domain-like 0.00000508
Further Details:      
 
Domain Number 6 Region: 964-1099
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.75e-36
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123966133|ref|YP_001011214.1|
Sequence length 1100
Comment carbamoyl-phosphate synthase, large subunit [Prochlorococcus marinus str. MIT 9515]
Sequence
MPQRGDLKRILILGSGPIVIGQACEFDYSGTQACKALRKAGYEIILINSNPASIMTDPDI
ANKTYIEPLTPEIVSQIILKEKPDAILPTMGGQTALNLAVKLSESNFLKNNNVELIGADL
KAINKAEDRKLFKESMEKINVNVCPSGIASDLVEAMKVSKQINSYPLIIRPAFTLGGVGG
GIAYNLEEFNDLCKSGLDESPSNQILIEKSLIGWKEFELEVMRDTSDNVVIICSIENLDP
MGVHTGDSITVAPAQTLTDKEYQRLRDLSLKIIREVGVETGGSNIQFAVNPNNGDVIVIE
MNPRVSRSSALASKATGFPIAKIAALLSVGYTLDEIINDITKKTPACFEPSIDYVVTKVP
RFAFEKFKGSSNILNTAMKSVGETMAIGRSFEESFQKALRSLEIGIFGWECDSIEDFNNE
NDLKNNLRNPTAERILIVKKAMEAGKSDSYINEITNIDLWFLEKLRNIFNFQNQFLKEKN
LNEIDRDLMLRAKQIGFSDQQIAKLTDSDFFEVRNYRKKLNILPLYKTVDTCSAEFSSET
PYHYSTYEESFSESNLHFSDNESYSNKANPAKKIMILGGGPNRIGQGIEFDYCCCHASYQ
SSSNGYQTIMVNSNPETVSTDYDTSDILYFEPVTFEDILNIIEAENPYGLIVQFGGQTPL
KLSLPLSNWLKSKEGLKCNSKILGTSPLSIDIAEDREEFTKILKDLNIRQPLNGIARTQE
EALSVSQNIGFPLVVRPSYVLGGRAMEIVKDKIELSRYISEAVKVSPDHPILLDQYLSNA
IEIDVDALCDENGSVVIAGLMEHVEPAGIHSGDSACCLPSISLSQLTLETVKEWTKLIAN
RLNVVGLINLQFAVTNINHQENELYILEANPRASRTIPFVSKAIGKPVAKLATQLMQGSS
LKDINYTEEIIPKYQAVKEAVLPFKRFPGSDTLLGPEMRSTGEVMGLAEDFGLAYAKSEL
ASGNGVPSEGVAFLSTNDLDKDKLEEIARELIVLGFKLIATKGTASYLLNLGIEVDEVLK
VHEGRPNIEDLIRSGLIQLVINTPIGSQAFHDDAYLRRAALEYNIPTFTTIPGAKAALQA
IKSLRINKIDTLSLQEIHKD
Download sequence
Identical sequences A2BWE6
WP_011820211.1.83733 167542.P9515_09001 gi|123966133|ref|YP_001011214.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]