SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966150|ref|YP_001011231.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966150|ref|YP_001011231.1|
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily Formyltransferase 3.14e-57
Family Formyltransferase 0.00000516
Further Details:      
 
Domain Number 2 Region: 212-315
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 4.12e-16
Family Post formyltransferase domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123966150|ref|YP_001011231.1|
Sequence length 328
Comment methionyl-tRNA formyltransferase [Prochlorococcus marinus str. MIT 9515]
Sequence
MRIIFWGTPEYSVKSLEVLKKSDHEILAVITQPDKKRSRGNKLIASPVKQYAMKEGLPVF
TPETLKKNDHFISLLKEFSCDLFVVIAYGKILPKKILDIPKYKSWNAHASLLPRWRGAAP
IQWSILEGDDFTGVGIMRMEEGLDTGDVLVEKQIKIEKEDNLQTLTKKLSDLSSELLLKA
ISKIEQNKNKDINHLLKKQKDLQRKLKYARMINKSDYIIDWANNSTDIYRKINALYPRVS
TTFKKKNLKIIKIKILTTDEIQNKNYKIVSDKFKPGYVIGLIENKGIIISTKTDPILLLE
AKLEGKNISKQKQLLQQLNPLIGEKFSD
Download sequence
Identical sequences A2BWG3
gi|123966150|ref|YP_001011231.1| WP_011820228.1.83733 167542.P9515_09171

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]