SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966181|ref|YP_001011262.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966181|ref|YP_001011262.1|
Domain Number 1 Region: 3-352
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.9e-99
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.000000117
Further Details:      
 
Domain Number 2 Region: 349-508
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 8.41e-31
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123966181|ref|YP_001011262.1|
Sequence length 511
Comment methionyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9515]
Sequence
MSFVITTPLYYVNDKPHLGSIYTTLICDSIARFKRLSGDNVIFITGVDEHGLKIQRTASN
KGVDPQSHCDEISDIFKQNWKSWDITNNKFVRTSSQNHESIVNEFYNRVKASGDIYMGVQ
KGWYCVGCEEFKENPENLSSYKCPIHQKNLEWKNEENLFFRLSKYQSQIEELINEPSFIY
PKERRNEIINFVSKGLKDFSVSRTNVSWGISVPDTKDHTFYVWFDALLGYVSAICPNMSD
PSLESSINNGWPADIHFIGKDILRFHAVYWPAMLLSAGMDVPKRVFGHGFLTREGQKMGK
SLGNVLDPNLLLSKYGKEAVRWYLLKDISLGSDGDFQNKRFVDIINNDLANTIGNLLNRT
SSMSRKWFDNKVPDTYELIIDNTLQLCCNEAVEKFINHFNLYELDLAANVILNLAINTNL
YLNEKQPWKLIKDENNISIVCNIIYDVLESTRIIGLLLLPILPDLSSKINMQLGSLYNKN
ESWNDQLNWGLLKSKSNLPAPYPIIEKLEYE
Download sequence
Identical sequences A2BWJ4
WP_011820258.1.83733 gi|123966181|ref|YP_001011262.1| 167542.P9515_09481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]