SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966204|ref|YP_001011285.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966204|ref|YP_001011285.1|
Domain Number 1 Region: 18-242,432-676
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.27e-139
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000204
Further Details:      
 
Domain Number 2 Region: 242-424
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 1.04e-40
Family ValRS/IleRS/LeuRS editing domain 0.0000264
Further Details:      
 
Domain Number 3 Region: 672-864
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.8e-35
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123966204|ref|YP_001011285.1|
Sequence length 864
Comment leucyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9515]
Sequence
MIYSENTDEKSNQHTNNLYKPCEIENKWQEIWDKENLYKTDDKSSKKEKFYALSMFPYPS
GNLHMGHVRNYVITDLIARFQRFQGKSLLHPMGWDAFGLPAENAAIERGINPNDWTKKNI
AHMKSQLKLLGLSVDWDKEFATCDENYYLWTQFLFLELHKSGLVYQKESEVNWDPIDNTV
LANEQVDSEGKSWRSGAKVEKKLLTQWFLKITNYTEELLQDLEKLSEWPERVKIMQENWI
GKSKGANIIFKINEFENEKIKVFTTRPDTLFGVTYIAISINNPLINKISDNEILSKLENL
KIYLKKNQDKDQKKIGIPTNLKAINPINSNEIPIWIASYVLDEYGTGAVMGVPAHDQRDF
EFAKINFIDIKQVIIKDKDNDKSTFKLKNAFTDNGFLINSNNFNGLCNNDAKKQILEQGK
INGWAEEEIHYRLRDWLISRQRYWGCPIPIIKCNNCGSIPVNKKNLPVKLPKEIEISSNK
INSLGSYKDWVKTTCPKCGNLASRETDTMDTFMCSSWYFLRYPSSKCKTKPFEKDNVNKW
LPVDQYVGGVEHAILHLLYARFLTKALRDNNLFDIDEPFKKLLTQGMVQAAAYKNTKTGK
YISPKDIKDFNNPTDPNDDSKLEVLFEKMSKSKYNGIDPESVIKKYGADTARMFILFKAP
PEKDLEWGDSDVEGQYRFLCRIWKLFLDYRNNESWDNQKNYNREKENSLTKSINIAIKEI
SNDIKNNQFNTAISELMKFYNSLSSSMIYVNKDLRKDAFKKFCILLAPFAPHIAEEIWNL
IGYQKSVHLERWPIFNEDALKEDCYELVIQINGKVRDKINVGIDISEDQIKQKTLTRPNV
RKWIDQKTIRKIIIVKGKIMNIVV
Download sequence
Identical sequences A2BWL7
WP_011820280.1.83733 167542.P9515_09711 gi|123966204|ref|YP_001011285.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]