SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966242|ref|YP_001011323.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|123966242|ref|YP_001011323.1|
Domain Number - Region: 69-114
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 0.00628
Family Argininosuccinate synthetase, C-terminal domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123966242|ref|YP_001011323.1|
Sequence length 117
Comment photosystem II reaction center protein Psb28 [Prochlorococcus marinus str. MIT 9515]
Sequence
MAANNLAKIQFYEGTNEPVVPEIRLTRGNDGTTGQAIFIFEKPQALSSITEGEITGMRMI
DSEGEIMTREVKVKFVDGEPMYLEGTYIWKTKSDFDRFMRFANSYAKSNGLGYSEKK
Download sequence
Identical sequences A2BWQ5
WP_011820317.1.83733 167542.P9515_10091 gi|123966242|ref|YP_001011323.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]