SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966261|ref|YP_001011342.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966261|ref|YP_001011342.1|
Domain Number 1 Region: 4-229
Classification Level Classification E-value
Superfamily PHP domain-like 4.51e-32
Family PHP domain 0.017
Further Details:      
 
Weak hits

Sequence:  gi|123966261|ref|YP_001011342.1|
Domain Number - Region: 837-870
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0274
Family Tex HhH-containing domain-like 0.055
Further Details:      
 
Domain Number - Region: 984-1081
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0942
Family Single strand DNA-binding domain, SSB 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123966261|ref|YP_001011342.1|
Sequence length 1165
Comment DNA polymerase III subunit alpha [Prochlorococcus marinus str. MIT 9515]
Sequence
MGFVPLHNHSDYSLLDGASQVSKIVDRASELGMESIALTDHGVMYGVLDLVKKCKDKGIK
PIIGNEMYIINGSIDDPQPKKEKRYHLVVLAKNHEGYKNLVKLTTISHLNGMRGRGIFSR
PCIDKSLLEKYKDGLIISTACLGGEIPQAILKGRIDVAENIACWYKNLLGEDFYLEIQDH
GSMEDRIVNVEMIRIGKKYQIKVIATNDAHYISNMDVEAHDALLCVLTGKLISDEKRLRY
TGTEYIKSEIEMLRLFNDHIDNESIKEAINNTVEVSQKIEVFDLFGTYRMPKFPLKEEKD
SLSFLTKISKEGLLKRLNKANLDEVDEIYTKRLSSELKIINDMGFPDYFLVVWDYIKFAR
DNSIPVGPGRGSAAGSLVAFSLQITNIDPVKHGLLFERFLNPARKSMPDIDTDFCIDRRS
EVIDYVTNRYGEDKVAQIITFNKMTSKAVLKDVARVLDIPYGESDKLAKLIPVVRGKPYK
LNEMIDKKSPSPEFRDKYLKDSKVKRWVDLALRIEGTNKTYGVHAAGVVIASESLDMLVP
LQRNNEGQIITQYSMDDIESLGLLKMDFLGLKNLTMIDKTISLIESSTGQKINVDELPPN
DNKTFDLIGRGDLEGIFQLESSGMKQVVKDFKPNSLEDISSILALYRPGPLDAGLIPKFI
NRKNGSEKIDFPHPLIKSILTETYGIMVYQEQIMKIAQDLAGYSLGDADLLRRAMGKKKV
SEMVKHRNIFIEGACKKGVDKKIANDLFDQMVLFAEYCFNKSHSTAYGAVTYQTAFLKAH
YPVAYMASLLSVNAGSSDKMQRYISNCYSMGIEVISPSINSSGIDFTVKKDQILFGLSAI
KNLGDSAIKNIIENRNKLGNFKSFSDLCDRLPSNILNKRNLESLIHCGALDEFSENKNRA
QLFSDLDYVMEWASSRNRDRISGQGNLFDSISNIEHKEFSLPKGSKVDDYSLIEKLKLEK
QLLGFYLSDHPLKHLAKPAKLVSPISISQLENSHDRTKVSLVGMIPELKQITTRKGDRMA
IVQLEDLSGTCEAIVFPKTYCRLSEFLLTDTRLLVWGTIDKKSDKTQLIIDDCREIDNLK
LLVIDLDNSQASDIRIQNTIRDCLVKFKPDRDKCGIKIPVLAAVKNNESTTYVKFGDQFC
VGDIVGVTKLLSDKSFQVNLKSLIA
Download sequence
Identical sequences A2BWS4
167542.P9515_10281 WP_011820336.1.83733 gi|123966261|ref|YP_001011342.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]