SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966494|ref|YP_001011575.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|123966494|ref|YP_001011575.1|
Domain Number - Region: 81-137
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0714
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123966494|ref|YP_001011575.1|
Sequence length 184
Comment hypothetical protein P9515_12611 [Prochlorococcus marinus str. MIT 9515]
Sequence
MVHSTLNFMAYILINTFSIFSSLLPALNEKNLPWIDVIHPIVVHFVIAMALGAVVFDFVG
IIFKKPNLYEVSFLNLTVATIAIFIAIVFGQIEAGLSNPYGVSRDILNYHSTIGWSLAGV
LSVITGWRYVSRQSNPQVLSKGFVFVDLILAALVCTQVYLGDMLVWIYGLHTVPVVQAVR
EGLL
Download sequence
Identical sequences A2BXF7
167542.P9515_12611 gi|123966494|ref|YP_001011575.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]