SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966538|ref|YP_001011619.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966538|ref|YP_001011619.1|
Domain Number 1 Region: 2-315
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.6e-92
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000249
Further Details:      
 
Domain Number 2 Region: 347-490
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.22e-23
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123966538|ref|YP_001011619.1|
Sequence length 492
Comment cysteinyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9515]
Sequence
MIKLFNTLSKNVEVFKPIDEEVKIYCCGVTVYDLCHLGHARSYIAWDVLRRFLIYSDYKV
KFVQNFTDIDDKILKRAKEENSSMKQVSEKNIAEFHKDMDALGIMRPDSMPKATNHICNI
CSFIKVLEKKGFAYARGGDVYYSVFKNKDYGKLSNQNILEQNINQQGRMTSDESNKKNNP
QDFALWKKAKENEPSFDSPWGKGRPGWHIECSAMVKDELGETIDIHLGGADLIFPHHENE
IAQSESANNKKLANYWLHNGMVNVNGQKMSKSLKNFTTIRDLLDSGTSPMTLRYFVLTVN
YRKPLDFTDEALKSASEAWKTINVALSFFDITKKENLSIEVNETNEFVEEKYKEKINYEI
SQKKIKFTNALNNDLNTAGAIAIIYELAKPLKNFINQFQRIKNLDINTNEKFHLRETLKT
LEELTQVLGLKKEEIIIENKITEEQIISLINKRLIAKKGRDYAEADKIRNSLKEKGIELI
DQSTELTTWVRL
Download sequence
Identical sequences A2BXK1
gi|123966538|ref|YP_001011619.1| WP_011820611.1.83733 167542.P9515_13051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]