SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966543|ref|YP_001011624.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966543|ref|YP_001011624.1|
Domain Number 1 Region: 299-472
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 5.14e-68
Family Transhydrogenase domain III (dIII) 0.00000232
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123966543|ref|YP_001011624.1|
Sequence length 478
Comment nicotinamide nucleotide transhydrogenase, subunit beta [Prochlorococcus marinus str. MIT 9515]
Sequence
MNLPDIIKFVIDLLAVLLLALGIKGLSKVRSAREANILAAFAMFLSVVGLLSYYLGTSGI
PAQSWIWIIVGSLVGSLFGTLLAKKVPMTSMPETVALFNGFGGMSSLLVAIGAFLFPFNE
LAKAGSLEPFINNVSISVSIFVGAITFSGSIVAMAKLQGWLSTPRWTQVKARHFVNIVFG
VTSFVAFIYLISGNISSIWLLVIASTLLGIGVTLPIGGADMPVVISLLNSYSGIAAAAAG
FVVDSQLLIVAGAMVGAAGLILTQVMCKGMNRSLISVLFGGTLSQQSISSSGSSEYTNIT
SCSVEECALTLEAANRVIVVPGYGLAVAQAQHTLREVTKKLEQNGIEVVYAIHPVAGRMP
GHMNVLLAEADVPYEQLKEMDIVNPEFPATDVVLVLGANDVVNPQAKNDKSSPLYGMPVL
DVQEARTVFVIKRGMSAGYSGIKNDLFDLPNTSMVFGDAKKVLSELISELKDLGVGDK
Download sequence
Identical sequences A2BXK6
WP_011820616.1.83733 gi|123966543|ref|YP_001011624.1| 167542.P9515_13101

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]