SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966667|ref|YP_001011748.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966667|ref|YP_001011748.1|
Domain Number 1 Region: 167-305
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 5.23e-37
Family ATP-dependent riboflavin kinase-like 0.0014
Further Details:      
 
Domain Number 2 Region: 14-171
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.53e-23
Family Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123966667|ref|YP_001011748.1|
Sequence length 307
Comment riboflavin kinase/FAD synthase [Prochlorococcus marinus str. MIT 9515]
Sequence
MISLISPSEVKNPTSIAIGSFDGVHAGHRQLIDSVVKENKYTPTIASFWPHPREILYGET
RLRLDLPEEKLPILEDLGIEQLVLIPFDKNLSRLSADNFIKEILINQLQAKSISVGANFR
FGYKRSGDINTIKLITRDMDIKLKIISILKDNEGRISSSRVRDLLQKSDLKNALRILNRP
YSFKGKVVKGKGIGKRLGFPTANLEIDGRKFLPGEGVYAAWSTINNSPNKIASVMNLGSQ
PTIDPLLPSAVEVHLINKDIDLYDLNLSVEPVEKLRSQIKFQNIDQLSNQITIDRENALK
ILNEHSK
Download sequence
Identical sequences A2BXY0
gi|123966667|ref|YP_001011748.1| WP_011820738.1.83733 167542.P9515_14341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]