SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966684|ref|YP_001011765.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966684|ref|YP_001011765.1|
Domain Number 1 Region: 15-254
Classification Level Classification E-value
Superfamily YjeF N-terminal domain-like 2.09e-46
Family YjeF N-terminal domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 230-505
Classification Level Classification E-value
Superfamily Ribokinase-like 3.33e-41
Family YjeF C-terminal domain-like 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123966684|ref|YP_001011765.1|
Sequence length 522
Comment fused sugar kinase/uncharacterized domain-containing protein [Prochlorococcus marinus str. MIT 9515]
Sequence
MKEIGWPTIDSKHLVVYSKQMLDLENRMFSKGMPQEALMEKAGIQISRWLLKRKFLLNKG
VIVLIGPGHNGGDGAVIAKELFLKGYLVKLWCPFPLKKTLTINYVNYLTTIGVEKLLEPP
NPDEKHLWIDAIFGNNQKRKVDEELIELLNKKFNKKSGKVVSVDVPTGLCPNSGKPFSQN
AVKANYSLVIGLNKIGLLQDTALAYVGELHHIDIGITKDQLSKLKSQITKITLEDLKTIN
LPLLPKNSSKYKRGRSLLIAGSEKYPGAARLAIKGAISSGAGFVSAILPELVAKSIWQVE
PEVVIKGRLKSDLDGNSILFDALKNIDLSCYDSIVIGPGIGLNYGDWEKSTEYLLGFKGL
LILDADALNRISKSNLGSKFFLERKSQTWITPHNKEFLRLFPEMDSTNRVELAIKAAKEF
NISILLKGANSVIANYERAWQLCETDAETARAGLGDLLSGFIGGCSSIDLSHPSNLIKTE
SLAKYVFLHSIAASKCKKGSTSSVIGDELSKLMRKTKARQMS
Download sequence
Identical sequences A2BXZ7
167542.P9515_14511 WP_011820755.1.83733 gi|123966684|ref|YP_001011765.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]