SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966716|ref|YP_001011797.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966716|ref|YP_001011797.1|
Domain Number 1 Region: 126-551
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.24e-107
Family Amylase, catalytic domain 0.00000442
Further Details:      
 
Domain Number 2 Region: 1-133
Classification Level Classification E-value
Superfamily E set domains 2.24e-18
Family E-set domains of sugar-utilizing enzymes 0.0071
Further Details:      
 
Domain Number 3 Region: 565-656
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 3.96e-16
Family alpha-Amylases, C-terminal beta-sheet domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123966716|ref|YP_001011797.1|
Sequence length 668
Comment isoamylase [Prochlorococcus marinus str. MIT 9515]
Sequence
MPLGSSITSKGVNFSLIATNAEYIEILVFEKEDSVAPKAIFKLDQNHKTGPYWHAEINDL
KEGSIYAFRIKQKVNEPNKDYSKTVLIDPCSRGITGWSKYSRKNALNNFDNMDSCLKSVV
CDRKVFNFKNFPRPKHSWEETIIYELHIKAFTQSSNEDESCFKKFLKKIPYLKELGITSI
ELLPVFCFDPNDAPNGLENFWGYSPINWFTPHFQYLSNKSAEQNREEFRKFVEECHKENI
EVILDVVYNHTSEGDSGGPAISWKGIDENLYYFIDKDKNYQDVTGCGNTIAANRGLVRKL
IIESLKCWANEFGVDGFRFDLGIALSRGEDLVPLDNPPIFEDIECEPELADIKLISEPWD
CGGLYKLNNFPSKKTFTWNGHFRDDLRRFWRGDKDSAWNMSDKIKGSPSHYKENISFPKS
INFITSHDGFTLKDLVSFNKKHNFANKEQNRDGDNHNNSWNHGVEGPTSNLFIKKLRKRQ
QKNFLLSLLISKGVPMILMGDEIGRSQGGNNNSWCQNNSLGWMNWDESQQDLELLTYLKY
LIKIRKKFIKFFNPISPQNRKDIDNLVNYYWHGAKLESPDWSSWSHTIAFSMNKGKNNPL
IWAGLNAYTKSIDFHLPESKSKWLKVVDTNESGTIMPIPLEHKSITVENRSSVLIISEEV
FGTKNIIF
Download sequence
Identical sequences A2BY29
gi|123966716|ref|YP_001011797.1| 167542.P9515_14831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]