SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966734|ref|YP_001011815.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966734|ref|YP_001011815.1|
Domain Number 1 Region: 118-332
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.13e-54
Family BC ATP-binding domain-like 0.00000761
Further Details:      
 
Domain Number 2 Region: 15-117
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.17e-28
Family BC N-terminal domain-like 0.00027
Further Details:      
 
Domain Number 3 Region: 342-435
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 1.2e-24
Family BC C-terminal domain-like 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123966734|ref|YP_001011815.1|
Sequence length 445
Comment phosphoribosylglycinamide synthetase [Prochlorococcus marinus str. MIT 9515]
Sequence
MSINSNNSKNSNKLENILIIGNGGRENALAWAIQKNELIKRIYLLPGNAGSKNINKSERI
NLDLNNIEALIKKLKSLNIDLVVIGPETYLADGLGGILRKNNFDVFGPGSDGAKLESSKS
WAKEFMREAKIPTANFWKIKSLEEAKEIIFKSPNPLVVKADGLASGKGVYIPETKESSLQ
ATEEIFKGKFGNAGKTIVLEEKIEGPEVSVFALCDGKKYVLLPTAQDHKRLNENDKGPNT
GGMGAYSPTPLITKTNLEKITNEIIEPTINTLLKKNIDYRGVLYFGLMITKSGPKVIEYN
CRFGDPECQTIMPLLDENFVILLQKCSKGNLIGNETIKMPDKFSGCVIATSKGYPLKYEI
GFPIDFGNIDKEDCQIFDSGTSLNSNGEVITNGGRVLSIVCQGKDFDKVFEKAYKNLKEI
SFEGIFYRKDIGHQVRTKTLDDEIN
Download sequence
Identical sequences A2BY47
167542.P9515_15011 gi|123966734|ref|YP_001011815.1| WP_011820804.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]