SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966862|ref|YP_001011943.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966862|ref|YP_001011943.1|
Domain Number 1 Region: 2-202,234-314
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 2.35e-85
Family ATP synthase (F1-ATPase), gamma subunit 0.0000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123966862|ref|YP_001011943.1|
Sequence length 316
Comment F0F1 ATP synthase subunit gamma [Prochlorococcus marinus str. MIT 9515]
Sequence
MANLKEIRDRIVSVKNTRKITEAMRLVAAAKVRRAQDQVLKSRPFADKLARVLENIQSRV
QFEAVDSPLLSKREVKSISLVCITADRGLCGGYNTNIIKKVEIRYAELIKQGYEPNLILV
GKKAIGYFQNRKDKYVIKSTFKELEQVPTAIDSEGITNEVLAEFLSENSDRVEIIYTKFI
TLVSCAPVVQTLLPLDPQGIAQENDEIFRLTTKNSKLLVEKSNLEKNESDRLPSDIVFEQ
SPDQLLDSLLPLYLQNQILRALQESAASELACRMTAMNNASDNAKELASTLNLTYNKARQ
AAITQEILEVVGGSAV
Download sequence
Identical sequences A2BYH5
gi|123966862|ref|YP_001011943.1| 167542.P9515_16291 WP_011820931.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]