SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966879|ref|YP_001011960.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966879|ref|YP_001011960.1|
Domain Number 1 Region: 5-458
Classification Level Classification E-value
Superfamily L-aspartase-like 6.04e-133
Family L-aspartase/fumarase 0.00000000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123966879|ref|YP_001011960.1|
Sequence length 461
Comment fumarate hydratase [Prochlorococcus marinus str. MIT 9515]
Sequence
MTKNFRFEKDSMGKIKVPAEALWGAQTQRSIINFSIGEELIPLELIYSITLIKKAAAIAN
FKLGLINDVKKDLIIEACTEILDGYHDSQFPLKIWQTGSGTQTNMNINEVISNIAALKTN
SELGTHNPIHPNDDVNKSQSTNDTFPAAIQISVVTEIIKKLVPSIKELTKVLDKKSNEWK
NLIKIGRTHFQDAVPISLGQEVSAWSKQLKDAEDTLLVSLDELCFLPLGGTAVGTGINCP
KDFPEESIKSISDDTNVVFYKSNNHFSLMASHDRLANVMGQIKILASALFKISNDIKILS
SGPRSGIYELIIPQNEPGSSIMPGKVNPTQCEALSMVCTQVMGFEYAVSIANASGTLQMN
EYKPLIGFNILRSIKLLNNAISNFRLKLIEGIQPNPETIKANLENSLMLVTALVPKIGYE
KAAEIANLAFNESINLKEATLKLGYLSANDFEDAINTDQMI
Download sequence
Identical sequences A2BYJ2
167542.P9515_16461 gi|123966879|ref|YP_001011960.1| WP_011820947.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]