SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966921|ref|YP_001012002.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966921|ref|YP_001012002.1|
Domain Number 1 Region: 9-226
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.14e-60
Family G proteins 0.000000149
Further Details:      
 
Domain Number 2 Region: 298-398
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 4.32e-34
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.0000121
Further Details:      
 
Domain Number 3 Region: 205-301
Classification Level Classification E-value
Superfamily Translation proteins 1.85e-31
Family Elongation factors 0.00000862
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123966921|ref|YP_001012002.1|
Sequence length 399
Comment elongation factor Tu [Prochlorococcus marinus str. MIT 9515]
Sequence
MAREKFERNKPHVNIGTIGHVDHGKTTLTAAITNVLAKKGQAQAQDYGDIDGAPEERERG
ITINTAHVEYETEGRHYAHVDCPGHADYVKNMITGAAQMDGAILVCAATDGPMAQTKEHI
LLAKQVGVPALVVALNKCDMVDDEEIIELVEMEIRELLDSYDFPGDDIPIVQVSGLKALE
GDSNWESKIEELMKAVDASIPEPEREIDKPFLMAIEDVFSITGRGTVATGRIERGKVKVG
EEVEIVGIRDTRLTTVTGVEMFRKLLDEGMAGDNVGLLLRGVQKEDIERGMVLVKKGSIT
PHTKFEGEVYVLKKEEGGRHTPFFAGYRPQFYIRTTDVTGQITAFTSDDGANVEMVMPGD
RIKMTGELICPVAIEQGMRFAIREGGRTIGAGVVSKIIE
Download sequence
Identical sequences A2BYN4
167542.P9515_16881 gi|123966921|ref|YP_001012002.1| WP_011820988.1.83733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]