SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123966923|ref|YP_001012004.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123966923|ref|YP_001012004.1|
Domain Number 1 Region: 2-149
Classification Level Classification E-value
Superfamily Ribosomal protein S7 1.7e-58
Family Ribosomal protein S7 0.0000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123966923|ref|YP_001012004.1|
Sequence length 156
Comment 30S ribosomal protein S7 [Prochlorococcus marinus str. MIT 9515]
Sequence
MSRRNAAVKRPVLPDPQFNSRLASMMISRLMKHGKKSTAQKILSDAFSLISERTGGNAVE
LFETAVKNATPLVEVRARRVGGATYQVPMEVRQERGTAMALRWLVTFSRGRNGKSMSQKL
AGELMDAANETGSAVKKREDTHKMAEANKAFAHYRY
Download sequence
Identical sequences A0A2D7TKS0 A2BYN6 Q7UZY5
WP_011133138.1.27332 WP_011133138.1.67920 WP_011133138.1.83733 gi|33862066|ref|NP_893627.1| 167542.P9515_16901 59919.PMM1510 gi|123966923|ref|YP_001012004.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]