SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123967024|ref|YP_001012105.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123967024|ref|YP_001012105.1|
Domain Number 1 Region: 26-163
Classification Level Classification E-value
Superfamily RNase III domain-like 1.43e-28
Family RNase III catalytic domain-like 0.0013
Further Details:      
 
Domain Number 2 Region: 129-243
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 3.46e-22
Family Double-stranded RNA-binding domain (dsRBD) 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123967024|ref|YP_001012105.1|
Sequence length 249
Comment ribonuclease III [Prochlorococcus marinus str. MIT 9515]
Sequence
MNNVIEKKRTEQIIQFLNSLDIDSKRFFEIINKKDQLIICTFNEALTHSSADKIVNYEKL
EFFGDAVLRLSASDFIERKYKNMSVGNRSELRSQLVSDEWLTELGKKIFIEKVIVKGPKA
IGDENSKDTIIAETSEALIGAIYKCFNSIHEVNIWLDNFWEKDAELYLKAPHKYNAKSAL
QEWCQKHGFDLPIYKIYEVSSSHGDPKRFSCDIYLNGSKEASSFGNSHKKAEKNAATILI
EKIFQKEQN
Download sequence
Identical sequences A2BYY7
167542.P9515_17911 WP_011821084.1.83733 gi|123967024|ref|YP_001012105.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]