SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123967061|ref|YP_001012142.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123967061|ref|YP_001012142.1|
Domain Number 1 Region: 5-231,363-410
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.89e-78
Family Tandem AAA-ATPase domain 0.000000306
Further Details:      
 
Domain Number 2 Region: 723-940
Classification Level Classification E-value
Superfamily Helical scaffold and wing domains of SecA 9.02e-72
Family Helical scaffold and wing domains of SecA 0.00000997
Further Details:      
 
Domain Number 3 Region: 414-520,629-721
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.22e-48
Family Tandem AAA-ATPase domain 0.0000138
Further Details:      
 
Domain Number 4 Region: 230-363
Classification Level Classification E-value
Superfamily Pre-protein crosslinking domain of SecA 2.49e-40
Family Pre-protein crosslinking domain of SecA 0.0000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123967061|ref|YP_001012142.1|
Sequence length 943
Comment preprotein translocase subunit SecA [Prochlorococcus marinus str. MIT 9515]
Sequence
MLKLLLGDPNTRKLKRYQPIVEEINLLEEEVSILTDDELRNETHNLKSKVSLEINIKRQN
EKLEEILPKAFAIVREASKRVLEMRHFDVQLIGGMVLHEGQIAEMKTGEGKTLVATLPCY
LNALTGKGVHVVTVNDYLARRDAEWMGQVHRFLGLSVGLIQQDMSPAERKKNYACDITYA
TNSELGFDYLRDNMATEIEEVVQRKFNYCVIDEVDSILIDEARTPLIISGQIERPQEKYQ
KAAELALSLIKAKELSKDGIDPEGDYEVDEKQRSCILTDQGFAKCEESLKVNDLYDPQDP
WAHYITNALKAKELFVKDVNYIIKKDEAVIVDEFTGRVMPGRRWSDGQHQAIEAKEGLKI
QPETQTLASITYQNFFLLYPGLAGMTGTAKTEEVEFEKTYKLESTVVPTNQVRKRQDWAD
QVFKTEIGKWKAVANETAEIHRNGRPVLVGTTSVEKSELLSSLLFEQQIPHNLLNAKPEN
VEREAEIVAQAGRSGAVTIATNMAGRGTDIILGGNSDYMARLKLKETLMPLLVKPDNEHK
PPIPQQRSSKAGGGFASKSESISNKNSKSSGASLFPCQLGEDTTRKLSLLSNELVKSWGE
RTLTILELDDRIATAAEKAPTEDKLIQSLRDALSDVKNEYEKVLVHEEENVRKAGGLHVI
GTERHESRRVDNQLRGRAGRQGDLGSTRFFLSLEDNLLRIFGGDRVANLMNAFRVDEDMP
IESGMLTRSLESAQKKVETYYYDIRKQVFEYDEVMNNQRKAVYNERLRVLKGSDLKKQVL
GYGDRTMEEIVEAYINPDLPPEEWDIEQLISKVKEFIYLLNNLKSTDVSVLSVEELKNYL
QEQLRIAYDLKEAQIEQFRPGLMREAERFFILQQIDNLWREHLQSMDSLRESVGLRGYGQ
KDPLIEYKNEGYDMFLEMMTNMRRNVIYSMFMFQPQSEKETKS
Download sequence
Identical sequences A2BZ24
167542.P9515_18281 gi|123967061|ref|YP_001012142.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]