SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123967068|ref|YP_001012149.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123967068|ref|YP_001012149.1|
Domain Number 1 Region: 362-665
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.27e-76
Family DNA repair protein MutS, domain III 0.00000593
Further Details:      
 
Domain Number 2 Region: 682-904
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.41e-52
Family ABC transporter ATPase domain-like 0.00000134
Further Details:      
 
Domain Number 3 Region: 79-195
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 4.19e-33
Family DNA repair protein MutS, domain I 0.0000771
Further Details:      
 
Domain Number 4 Region: 194-338
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.19e-29
Family DNA repair protein MutS, domain II 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|123967068|ref|YP_001012149.1|
Sequence length 914
Comment DNA mismatch repair protein MutS [Prochlorococcus marinus str. MIT 9515]
Sequence
MQDETIIQKELFAINNELKLPKSSSKISDNLSTEELKKESQRRPRQRKNATNVINKFKNE
LHNKSRDNCINEKSFSYKTVEKEKLTPILKHYVKLKEENSDRLLLYRLGDFFECFFEDAV
LISNLLEITLTSKDAGKEIGKIPMAGVPHHAMERYCAELIKKNNSVVICDQLEKSTGNYG
TPLKRGVTRIITPGTVIEEGMLVAKKNNWITAIHLSKNISENLDEWGISRADVSTGELLT
MEGKSLPKLFDELVKLDTSEIIIGSNEEKSLLEEQNENITYTVTQETFFSINEASSTIKN
YFQILSLEGLGLKNLNNATKALGGLLNYLEKINPSNLENDSSLRISLDFPQIQFPKDHLI
IDYQTQKNLEIKNTQRENNYAGSLLWSIDKTYTCMGARCLRRWIDSPLLDIDEICKRQNI
ISNFLESKKLRIDTQNILRAMGDLERLSGRACAGHASPRDLIAISEGLKKLPKLKSIVNL
FKYKIPSWTDQLKNVDNELLELADLISFKLVGNPPLNTSEGGIIHDGVDNVLDGLRNLID
DYSDWLNEEELKERKISKISNLKIQFHKNFGYYISINKSKVNLAPDHWIKRQTLTNEERY
VTTEIKNKESKIFQVKNRAAAKEYELFCEIRNLVASKTKKIRSIAKSIACIDALLGLSIT
SLENNFIKPTLLPIQNSTTQQSTEIIKGRNPIVEQLLTNKEFISNDILFNNKQKLIILTG
PNASGKSCFIRQIGLIQILSQIGSFIPASKANIQIADRIFTRIGAVDDQSSGQSTFMVEM
SETASILNQATSNSLVLLDEIGRGTSTFDGLSIAWSVSEYLAKKIVCNTIFATHYHELNY
LKNTNKNVENFQVLVKQKKDQLYFCHKITKGGANKSYGIEAAKLAGVPKEVIDKAKLVLD
YLEKNNQLNSQIQI
Download sequence
Identical sequences A2BZ31
gi|123967068|ref|YP_001012149.1| WP_011821127.1.83733 167542.P9515_18351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]