SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123967080|ref|YP_001012161.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123967080|ref|YP_001012161.1|
Domain Number 1 Region: 80-436
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.84e-67
Family Extended AAA-ATPase domain 0.00000000882
Further Details:      
 
Domain Number 2 Region: 8-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000727
Family ClpX chaperone zinc binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|123967080|ref|YP_001012161.1|
Sequence length 455
Comment ATP-dependent protease ATP-binding subunit ClpX [Prochlorococcus marinus str. MIT 9515]
Sequence
MAKFDAHLKCSFCAKSQDQVRKLIAGPGVYICDECIDLCNEILDEELIDTQAKLNNSTQV
KKKLPINNPDTSIPFELTSIPKPLEIKTFLDNQVVGQESAKKILSVAVYNHYKRLTWRLK
EENKDNNSNDCHATKLQKSNILLIGPTGSGKTLLAQTLAEFLDVPFAVADATTLTEAGYV
GEDVENILLRLLQKSEMNVDLAQKGIIYIDEIDKIARKSENPSITRDVSGEGVQQALLKM
LEGTIANVPPQGGRKHPYHDCIQIDTSQILFICGGAFIGLEDIVQKRLGRHSIGFTTNSD
ESKIDAKKLVDSRDALKNLELDDLVKYGLIPEFIGRIPVCAVLDRLTKETLESILTEPRD
ALVKQFKTLLSMDNVELNFEPESVEAIANEAFKRKTGARALRSIIEELMLDLMYTLPSQE
EVTKFTITKKMVDNLFSSKIVKLPAGSHRIIKESA
Download sequence
Identical sequences A2BZ43
167542.P9515_18471 WP_011821139.1.83733 gi|123967080|ref|YP_001012161.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]