SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123967112|ref|YP_001012193.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123967112|ref|YP_001012193.1|
Domain Number 1 Region: 111-298,436-598
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.03e-103
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000829
Further Details:      
 
Domain Number 2 Region: 1-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.67e-30
Family Anticodon-binding domain 0.00019
Further Details:      
 
Domain Number 3 Region: 295-426
Classification Level Classification E-value
Superfamily GAD domain-like 3.43e-27
Family GAD domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123967112|ref|YP_001012193.1|
Sequence length 602
Comment aspartyl-tRNA synthetase [Prochlorococcus marinus str. MIT 9515]
Sequence
MRNKICEELNKSDIGKEVNLCGWVDRRRDHGGVIFIDLRDHSGFMQITINPEDGETLFKQ
AEILRNETVIMVNGIVNERPKDSINKNIITGELELKVQDLQILNQIKNNLPFPVSVHDYE
NTKEELRLKYRYLDIRRGKLLENLKTRHKIIKAIRNYLDNSGFTEVETPLLTKSTPEGAR
DFLVPARLSNGDFFALPQSPQLFKQLLMVGGLDKYYQIAKCFRDEDLRADRQPEFTQLDI
EMSFVSEEEIIAFNEKLIKHIWKNVLNINLNEDFPRMSWQEAMDNYGTDRPDTRYGMLLK
NLGEILGNIGFNIFTKAIQMGGAIKSITIKNGNSSISNVRIKPGGDIFKVAQEAGAGGLA
FIRVKGDELETIGAIKNNLNKDHISNILKITEAEDGDLILLGAGSTKIVNQSLDRVRQYI
AKDLNLLENQKAQSQWNFLWITDFPMFEMNEEEKRFEALHHPFCSPKNVKFEDKKELTKK
IETSTAYAYDLVLNGLELGGGSLRIHQAEMQKEVLRTVGLTDHQIDEKFGFLIEALEMGA
PPHGGIAFGLDRITMLILGVDSIRETIAFPKNQQAKCLLTNAPSNVSKSQLKELDIEITI
DE
Download sequence
Identical sequences A2BZ75
gi|123967112|ref|YP_001012193.1| WP_011821170.1.83733 167542.P9515_18791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]