SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|123967131|ref|YP_001012212.1| from Prochlorococcus marinus str. MIT 9515

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|123967131|ref|YP_001012212.1|
Domain Number 1 Region: 173-401
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 3.66e-88
Family Argininosuccinate synthetase, C-terminal domain 0.00000166
Further Details:      
 
Domain Number 2 Region: 5-206
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.03e-40
Family N-type ATP pyrophosphatases 0.0000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|123967131|ref|YP_001012212.1|
Sequence length 404
Comment argininosuccinate synthase [Prochlorococcus marinus str. MIT 9515]
Sequence
MQHPKKVVLAYSGGVDTSVCIPYLKNEYGISEVITFVADLGQGDDIESISQKALNSGATK
SVIGNLVEDFVEKYAFPAIRANALYGEKYPLSTALARPLIAENLVKLARKLNAGAVAHGC
TGKGNDQVRFDLAINALGPDLEIITPAREWKMSREEAILYGEKFGIPAPVSKKSPYSIDV
NLLGRSVEAGFLEDPMQEPNEEVFAMTSSIDDSPNYPKDIEITFKNGFPIAIGNESLSPL
KIIQKVNYLAGKNGFGRIDMIEDRVVGIKSREIYEAPGLLLLIKAHKELESITLNPDVLD
FKNLVEKKWAQLVYQGFWFGPLKKALDGFIDATQTSVNGKVKIRLHKGNAIIIGRSSENN
SLYREDLATYSKDDIFDHKQAEGFIYMWGMSNKIWAELNSKMNN
Download sequence
Identical sequences A2BZ94
WP_011821189.1.83733 gi|123967131|ref|YP_001012212.1| 167542.P9515_18981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]