SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152996367|ref|YP_001341202.1| from Marinomonas sp. MWYL1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152996367|ref|YP_001341202.1|
Domain Number 1 Region: 120-278
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 2.62e-46
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00029
Further Details:      
 
Domain Number 2 Region: 410-550
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 9.42e-39
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00091
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 6.05e-27
Family Duplicated SiR/NiR-like domains 1 and 3 0.011
Further Details:      
 
Domain Number 4 Region: 253-277,316-422
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.16e-22
Family Duplicated SiR/NiR-like domains 1 and 3 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|152996367|ref|YP_001341202.1|
Sequence length 553
Comment sulfite reductase [Marinomonas sp. MWYL1]
Sequence
MYQYDAIDQQLVEERVAQFRDQTRRYLNQELSEQEFLPLRLQNGLYVQRYAPMLRIAIPY
GMLSSTQLRKLADISCRYDRSYGHFSTRQNLQLNWPKIEDVPDILAELAEVQMHATQTSG
NCIRNTTTDQYAGVISDEVVDPRPYCELIRQWSTFHPEFAFLPRKFKIAVNATESADRAA
VQVHDIGLQIRKNDAGEIGFKVMVGGGLGRTPMVGVTISEFIPRVDLLTYLDAIIRVYNQ
QGRRDNKYKARIKILVKALGIEEFRSRVEAEWQHLRGKESTVPMSEFERLQGFFSEPNYE
TLENNPASVTNKLADSAGFARWFERNTFEHKKAGYRIVTLTLKKAGQAPGDATAEQMQRA
ADLADQFSFSELRVSHEQNLVLADVRQDQLVELWEAAKEAGFATPTLGLLTDMICCPGGD
FCALANAKSIPIAAQIQETFNDLDYLYDLGNIDLNISGCMNACGHHHVGNIGILGVDKKG
EEFYQISIGGASGHDASIGKILGPSFAQEEISSVIQKLMNVYVENRSEEERFIDTYRRVG
ITPFKEAAYAKAN
Download sequence
Identical sequences A6VXT8
400668.Mmwyl1_2345 gi|152996367|ref|YP_001341202.1| WP_012070046.1.45605

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]