SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|152996827|ref|YP_001341662.1| from Marinomonas sp. MWYL1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|152996827|ref|YP_001341662.1|
Domain Number 1 Region: 640-814
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 4.06e-51
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.0019
Further Details:      
 
Domain Number 2 Region: 9-197
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.01e-40
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0067
Further Details:      
 
Domain Number 3 Region: 510-648
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 2.62e-29
Family Duplicated SiR/NiR-like domains 1 and 3 0.014
Further Details:      
 
Domain Number 4 Region: 157-316
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.94e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0065
Further Details:      
 
Weak hits

Sequence:  gi|152996827|ref|YP_001341662.1|
Domain Number - Region: 804-846
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00903
Family Regulator of G-protein signaling, RGS 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|152996827|ref|YP_001341662.1|
Sequence length 852
Comment nitrite reductase (NAD(P)H) large subunit [Marinomonas sp. MWYL1]
Sequence
MTSTVSFLTTKPHLIVVGNGMVGHHFVEQIIAQGGHETFQITVFGEESYLAYDRVHLSEY
FTGKGAADLAMTDGTLYDEHGVRYFTNSLVTEIDREAKQLILQNGESLVYDKLVLATGSY
PFVPPIPGHKRDNTFVYRTLDDLDAIRACAKQVTRGTVVGGGLLGLEAANALKNLGLETS
VVEFAPRLMPVQLDEQGGAVLKEMIEGLGVQVYTNTATTEIVDGETAFHRMNFADGSHLE
TDLILFSAGIRPQDALAHQSGLSVGERGGICVNNHCQTSDENIYAIGECALWNNRIFGLV
APGYAMAKSAAGHLMGDAGVTFTGADMSTKLKLLGCDVGSVGDAHAQSQGCKVFVYQDEL
SQSYRKMMVSEDGKKLLGAVLVGDNSYYDTLLQYYLNGIDLPTQAQALILPAMDGAPVGL
GVDALPATASICSCHNVSKQDISDAVCNGALSVGDVKGITKAATGCGGCAALLKKVVDNE
LLALGVEVSTDICEHFAYTRQDLYNLVKVGGIKSFAELLKTHGKGHGCEICKPAVGSILA
SVWNDYVLKKEHISLQDTNDRFLANMQKDGTYSIVPRIPGGEITPERLIVLGEVAKEYGL
YTKVTGGQRIDLFGATLPQLPQIWEKLIAAGFETGQAYGKSLRTVKSCVGSTWCRYGVND
SMKMAIDLENRYKGLRAPHKIKFAVSGCTRECAEAQSKDIGVIATEGGWNLYVCGNGGMK
PRHGDLFAKDLDDETLVKYIDRVLMFYTKTADRLQRTSVWMEGLEGGLEYLKDVVINDKL
GLCAELEASMQHVVDTFQCEWKTTLKDPEALKTFRQFVNYEGSDSNVVFVEERDQMRPAT
EFEKQQLIAKVG
Download sequence
Identical sequences A6VZ48
WP_012070503.1.45605 400668.Mmwyl1_2815 gi|152996827|ref|YP_001341662.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]