SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|147669783|ref|YP_001214601.1| from Dehalococcoides sp. BAV1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|147669783|ref|YP_001214601.1|
Domain Number 1 Region: 60-125
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000000602
Family NfeD domain-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|147669783|ref|YP_001214601.1|
Sequence length 126
Comment hypothetical protein DehaBAV1_1144 [Dehalococcoides sp. BAV1]
Sequence
MNIRLVWTVFTTLLEGVGIAFLGLWLLPQIDFQLPLWVILLAEAVLLVSSVYFYHVGTVT
LDQKPHTGSETIIGSSAVVVESVNPKGMIRLDGELWEAVTSGVPIPRGGEVVVVGRDKMR
LWVKPK
Download sequence
Identical sequences 216389.DehaBAV1_1144 WP_012034104.1.45256 gi|147669783|ref|YP_001214601.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]