SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116754323|ref|YP_843441.1| from Methanosaeta thermophila PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116754323|ref|YP_843441.1|
Domain Number 1 Region: 4-148
Classification Level Classification E-value
Superfamily YutG-like 4.84e-34
Family YutG-like 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116754323|ref|YP_843441.1|
Sequence length 152
Comment hypothetical protein Mthe_1016 [Methanosaeta thermophila PT]
Sequence
MKDIVEVLRDEGITVDDIVATALELYVPHPGVETREKADAVFRRELNIALSDPNLALLIY
AGILLEERGRMKMLPNLRGEDYERDLTYLIADEVLGMSIAKYIGGYKGTFEYVRYDKAKP
GILSRLGPFMDDVIGGLIGGVSSNMYTRAGFS
Download sequence
Identical sequences A0B7X7
gi|116754323|ref|YP_843441.1| 349307.Mthe_1016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]