SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116754519|ref|YP_843637.1| from Methanosaeta thermophila PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116754519|ref|YP_843637.1|
Domain Number 1 Region: 4-438
Classification Level Classification E-value
Superfamily L-aspartase-like 5.34e-131
Family L-aspartase/fumarase 0.0000000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116754519|ref|YP_843637.1|
Sequence length 445
Comment adenylosuccinate lyase [Methanosaeta thermophila PT]
Sequence
MPIHPIDYRYGTPEMKAIWEEDYRISMLFRVEAALARAEEEVGLIPKGAADAIARAAEMA
SPQRAKEIEAEIGHDMMAVVLAMAEVCDYGEWIHLGATSNDILDTATGLQLKASLEIIEA
KLRELLRVLLDLAMENRNLVCAGRTHGQMAVPTTYGLRFAIWASEVARHIDRLREIRPRA
AVGKISGAVGTQAAFGPHGMTIQRRVMEILGLNEVDVSNQVVQRDRHAEVICLLALIAST
LDKICVEIRTLQRTEIAEVEESFGRRQVGSSTMPHKRNPIRSEQVCGLARVVRAQVEPAF
ANIPLWDERDLTNSSCERVIFPEAFVLTDHILNLTIRILKGLRIRKENVERNLTLLKGLN
MAEAVMVELAKRGAGRQTSHEILRAASMRAFEEGRELLDVLLEDGTVTKYISEDEIRELL
DPHRYTGTAVEQVERLEKKLRLYCE
Download sequence
Identical sequences A0B8H3
349307.Mthe_1218 gi|116754519|ref|YP_843637.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]