SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116754525|ref|YP_843643.1| from Methanosaeta thermophila PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116754525|ref|YP_843643.1|
Domain Number 1 Region: 98-279
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.94e-61
Family Formate/glycerate dehydrogenases, NAD-domain 0.00000668
Further Details:      
 
Domain Number 2 Region: 1-132
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 6.43e-43
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00016
Further Details:      
 
Domain Number 3 Region: 316-445
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 1.62e-32
Family SerA intervening domain-like 0.0011
Further Details:      
 
Domain Number 4 Region: 449-522
Classification Level Classification E-value
Superfamily ACT-like 0.000000000000104
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116754525|ref|YP_843643.1|
Sequence length 523
Comment D-3-phosphoglycerate dehydrogenase [Methanosaeta thermophila PT]
Sequence
MRVLVSDPLAEEGIRRLETAAEVDVITNLSPEELVERIKGYDALVIRSGTKVTADVINAA
DRLKVIARAGVGVDNVDVDAATKKGIIVVNAPGGNTISAAEHTIAMMLSLARNIPQAHAS
VRRGEWNRKKYTGVEVFNKTLGIIGLGRIGTEVAKRMKAFGMRILAYDPFITESKAAELG
IKLASLEEIYRESDFITVHTPLTPETRNMIDEPQIKMMKPTVRIINCARGGIINEAALAK
AVAENRIAGAAVDVYTKEPPVGNPLLEQERIITTPHLGASTAEAQINVALAVADQIIAIS
RGQLPTTAINLISIPPETIALMEPYMDIAERMGRLLGQLGTSRFEQLEIVYGGSIAEKDT
RLITIAAVKGLLSAIGAHANLVNSMALLKEKGIKLMESKTEVANGYSNLITMRLKTTSET
FAVHGTVYRPDDRRIVQINDYRVHVPTEGNLVLVLHEDRPNIIGPVCVVLGEANINIGSM
HVGRISAGKPQLMVLNVDTPLDDETMKRILSVSGVLSARRISM
Download sequence
Identical sequences A0B8H9
gi|116754525|ref|YP_843643.1| 349307.Mthe_1224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]