SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116754555|ref|YP_843673.1| from Methanosaeta thermophila PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116754555|ref|YP_843673.1|
Domain Number 1 Region: 128-397
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.83e-106
Family BC ATP-binding domain-like 0.00000013
Further Details:      
 
Domain Number 2 Region: 669-929
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.13e-103
Family BC ATP-binding domain-like 0.000000338
Further Details:      
 
Domain Number 3 Region: 392-543
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 2.75e-50
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000599
Further Details:      
 
Domain Number 4 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.12e-48
Family BC N-terminal domain-like 0.00000523
Further Details:      
 
Domain Number 5 Region: 546-668
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.6e-47
Family BC N-terminal domain-like 0.0000113
Further Details:      
 
Domain Number 6 Region: 933-1069
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 8.11e-37
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|116754555|ref|YP_843673.1|
Sequence length 1074
Comment carbamoyl phosphate synthase large subunit [Methanosaeta thermophila PT]
Sequence
MPKRSDIKKVLLIGSGPIQIGQAAEFDFSGSQACKSLREEGVEVVLVNSNPATIMTDPDM
ADKVYIEPLVPEIVAKIIEKERPDGIIAGIGGQTGLNITSELAEMGVLEKYGVEVLGTKV
RSIQEAEDRDLFKKAMERIGEPVPRSIAVTSLEEAEEAMKELGLPLIVRPAYTLGGSGGG
VARTHEELMRICEMGLKRSRIHQVLLEESVIGWTEVEYEVMRDSNNTCITICNMENMDPM
GIHTGESIVVTPIQTLSDHEIQMLRSAAINIIRALGIEGGCNIQFAVRNGEYRVIEVNPR
VSRSSALASKATGYPIARVTAKIAIGLTLDEIRNDVTKETPASFEPTVDYVVIKIPRWPF
DKFVKADRTLTTSMKSTGEVMAIGRSYEEALMKAIRSLDIDIDLGYNGKYVPWTDDDVRE
LLRTPTDERLFAIYQALRRGFSVEEISQLSMIDPYFIERIQNIIRMEDELKNGLTPDRLR
RAKKMGFLDSRIAELVGLSREEVTDYRLSLGIIPTYKMVDTCAAEFAASTPYYYSTYDEE
CELNPSDNKKVLILGSGPIRIGQGIEFDYCTVHAVTALREMGIEAHIINNNPETVSTDYD
TSDKLFFEPVTLEDVMNVIEKERYWGVMVQFGGQTAVNLAVPLEKELKRRGLKTVILGTS
PDSIDIAEDRERFNKLLNKLGIPQPKAGIAYSPEEAKRVAKEIGYPVLVRPSYVLGGRAM
EIVYDESGLELYMREAVRVSHEHPVLIDDFLQNAVEIDVDAVSDGRDVLIGAIMEHIEEA
GIHSGDSACMIPPQTLPEDVIATVKDYVRRIALALDVKGIINIQMAYKDGIVYVLEANPR
SSRTIPFVSKAVGLPLAKIAAKVMAGNTLREMNLNVEPEIPYVAVKEVLLPFDKLPGADV
LLGPEMRSTGEVMGIDYNMGLSFFKAEMSAENNLPLDGIVFISVRDEDKAEIAEVARRFV
NAGLKIIATDGTSGYLRGSGVPAERVRKIYHGSPNVLDYIRRGEVKLIINTPTTKQSVKD
GFQIRRSAVDYHVPYITTVQAAKAAAEAIEKALRGELTIKALDEYHREVRYRAL
Download sequence
Identical sequences A0B8K9
349307.Mthe_1254 gi|116754555|ref|YP_843673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]