SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|116754830|ref|YP_843948.1| from Methanosaeta thermophila PT

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|116754830|ref|YP_843948.1|
Domain Number 1 Region: 63-340
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.22e-59
Family Alanine racemase-like, N-terminal domain 0.0011
Further Details:      
 
Weak hits

Sequence:  gi|116754830|ref|YP_843948.1|
Domain Number - Region: 450-559
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.00126
Family Eukaryotic ODC-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|116754830|ref|YP_843948.1|
Sequence length 643
Comment arginine decarboxylase [Methanosaeta thermophila PT]
Sequence
MWKVDDSIALYGIHGWGDGYFSINEKGNVVVMPNKSSDSCVDVMDVIRRLETSGENLPVL
LRFPQIIEHRIWEIYRAFTGSISEFGYQGKYQPVFPMKVNQRKEVIEYILNYGREINIGL
EIGTKAELLAALTLDLPEDSLLICNGYKDDDFLRLALMFSDKHKIIIVVDLFEEIFDILR
LARSMEVRPLLGMRVKLFSKGSGRWAESGGESAKFGLSTIECLELLKILEENGLLDRLRM
IHFHIGSQITDIHRIKHAMNEAARIYAKVRKVAEIEYFNVGGGLSVDYDGSKSSGPSSAN
YTLREYSNDIVYTLQKICEEEGVPCPTIVSESGRAIAAYHSFLVFKIIGKKNSKDGFVAF
PLEGDPIQIEDLYFAFKNINLKNYKEYYHDALHYRDELLDSFNLGNIGLEERAKGEMLFW
MVCQKAVSLARHAGDNSEEFRELKKLVGQKYIGNFSLFQSVPDMWGVGQIFPIMPLHRLR
EVPSECGTIADITCDSDGEIKSFAGGKEAIELHKLSRSEDYYMGIFLLGAYQDTLGDFHN
LLGCVTEVHVLVEGRSWRISRRIPGDTCEKLLKFFNYDTEAYLQRLGERCATEPQLEAVL
EEVRRALSTTTYFNSPCLASETDEDKELLNSAAHRVMIETGRI
Download sequence
Identical sequences A0B9D4
gi|116754830|ref|YP_843948.1| 349307.Mthe_1536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]