SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OGLUM07G16180.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM07G16180.1
Domain Number 1 Region: 94-157
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000028
Family Ankyrin repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OGLUM07G16180.1
Sequence length 172
Comment pep:novel chromosome:ALNU02000000:7:18811811:18816731:1 gene:OGLUM07G16180 transcript:OGLUM07G16180.1 description:""
Sequence
MASIPCTFQLSARASSASAAAAARRSPRAAARLGWLRPSRLSAVVPASESGRVGPTCFFK
FGNKDAEGAGIYGSQGRDDFDRDDVEQYFNYMGMLAVEGTYDKMEALLNQDIHPVDILLM
LAASEGDKPKLEELLRAGAKYDVKDVDGRTALDRAADDTREFILGFAATLAA
Download sequence
Identical sequences A0A0E0AKN3 A2YLX7 A3BKF2
LOC_Os07g33660.1|13107.m03424|protein 39946.BGIOSIBCE024989 39947.LOC_Os07g33660.1 OGLUM07G16180.1 OsIBCD023654 LOC_Os07g33660.1|PACid:21902712 XP_015647220.1.37577

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]