SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM01G06590.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM01G06590.1
Domain Number 1 Region: 264-371
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.13e-16
Family Ankyrin repeat 0.0019
Further Details:      
 
Domain Number 2 Region: 50-189
Classification Level Classification E-value
Superfamily POZ domain 0.000000011
Family BTB/POZ domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OGLUM01G06590.1
Sequence length 579
Comment pep:novel chromosome:ALNU02000000:1:5119137:5123333:-1 gene:OGLUM01G06590 transcript:OGLUM01G06590.1 description:""
Sequence
MEPPTSHVTNAFSDSDSASVEEGGADADADVEALRRLSDNLAAAFRSPEDFAFLADARIA
VPGGGGDLRVHRCVLSARSPFLRGVFARRAAAAAGGGGEDGGERLELRELLGGGGEEVEV
GYEALRLVLDYLYSGRVGDLPKAACLCVDEDCAHVGCHPAVAFMAQVLFAASTFQVAELT
NLFQRRLLDVLDKVEVDNLLLILSVANLCNKSCMKLLERCLDMVVWSNLDMITLEKSLPP
DVIKQIIDARLSLGLISPENKGFPNKHVRRIHRALDSDDVELVRMLLTEGQTNLDDAFAL
HYAVEHCDSKITTELLDLALADVNHRNPRGYTVLHIAARRREPKIIVSLLTKGARPADVT
FDGRKAVQISKRLTKQGDYFGVTEEGKPSPKDRLCIEILEQAERRDPQLGEASVSLAMAG
ESLRGRLLYLENRVALARIMFPMEARVAMDIAQVDGTLEFNLGSGANPPPERQRTTVDLN
ESPFIMKEEHLARMTALSKTVELGKRFFPRCSNVLDKIMDDETDPVSLGRDTSAEKRKRF
HDLQDVLQKAFHEDKEENDRSGLSSLSSSTSIGAIRPRR
Download sequence
Identical sequences A0A0D9Y4H5
OGLUM01G06590.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]