SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM01G18360.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM01G18360.1
Domain Number 1 Region: 118-227
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.55e-29
Family B3 DNA binding domain 0.0024
Further Details:      
 
Weak hits

Sequence:  OGLUM01G18360.1
Domain Number - Region: 615-688
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0863
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM01G18360.1
Sequence length 699
Comment pep:novel chromosome:ALNU02000000:1:17653679:17656884:1 gene:OGLUM01G18360 transcript:OGLUM01G18360.1 description:""
Sequence
MLTFMELAGPTEGDGGGSVDSQLWAACAGSMSSVPPVGAAVYYFPQGHAEQASAAVDLSS
ARVPPLVPCRVVAVRFMADAESDEVFAKIRLVPLRPGDAVVDVGEAAAAEARREEENSRP
RPTSFAKTLTQSDANNGGGFSVPRFCAETIFPELDYSSEPPVQSVCAKDVHGVEWTFRHI
YRGTPRRHLLTTGWSPFVNKKQLTAGDSIVFMRDEGGNIHVGLRRAKRGFCSIGGDDESL
SSMPGWDQYRGLMRRNATATATGGRTPPKGKVPPENVLTAATRATTGQPFEVLYYPRAST
PEFCVRAAAVRTAMAVQWCPGMRFKMAFETEDSSRISWFMGTVAGVQASDPVRWPQSPWR
LLQVTWDEPELLQNVKRVCPWLVELVSSMPNLHLPSFSPPRKKPRNPPYAELPLEGQIFT
GPVFPPNPMAHDHHHHHGFPFLPFPDSSAQPAGIQGARHAQFASPFPEFHIGNLQPNLML
YAGIRLPPADRAAPAPRPPRIIISTDLTIGSPGKPDDAACSPSSGGKKIDDTKPRGFLLF
GQAILTEEQIKNGNSDGRPASPNWDAEKAPNTSEGSDSGVTQGSPTKNTTPSWSLPYFGG
NNISRASEYELNPGQCKVFVESEAVGRSLDLSALSSFEELYACLSDMFSIGSDELRSHLV
YRSPAGEVKHAGDEPFCAFVKSARKLRILTDAGSDNLGD
Download sequence
Identical sequences A0A0D9Y8Q9
OGLUM01G18360.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]