SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM01G32660.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM01G32660.1
Domain Number 1 Region: 181-279
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.45e-17
Family B3 DNA binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  OGLUM01G32660.1
Domain Number - Region: 90-100
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00314
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OGLUM01G32660.1
Sequence length 403
Comment pep:novel chromosome:ALNU02000000:1:32168216:32173323:1 gene:OGLUM01G32660 transcript:OGLUM01G32660.1 description:""
Sequence
MRGEERWQEQPALASHPSRATLRPRGWPRLGLAPTGVGSSCPPAPASELARHLARRAPVS
ASPPVLPPIKDQGARPPTLAASAAAASSPPPPPPPPPIPPLPPSTSTSAARPTDMAGVTS
KRRSSSASTSSSSGDGAAVSDRPRGVTRKRRSGGRCPRPAASLRPAAPRPSSHHTAGLRV
ILQKELRYSDVSQLGRIVLPKKEAEAYLPILTSKDGKKSLCMHDLQNAQLWTFKYRYWPN
NKSRMYVLENTGDYVRTHDLQLGDSIVIYKDDENNRFVIGAKKAGDQQAATVPQVDEHIS
TLFPIFPIAQVDDYLSPMAPQVDISAFVPHADENHEIFDGILNSLPEIPVANVRYSDFFD
PFDDGMDMANTLNANANQSASLHVTDDKSGHSLIPNPKSGPHM
Download sequence
Identical sequences A0A0D9YE12
OGLUM01G32660.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]