SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM01G45160.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM01G45160.1
Domain Number 1 Region: 76-174
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.77e-22
Family B3 DNA binding domain 0.0022
Further Details:      
 
Domain Number 2 Region: 577-667
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000706
Family B3 DNA binding domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OGLUM01G45160.1
Sequence length 673
Comment pep:novel chromosome:ALNU02000000:1:42580856:42584263:-1 gene:OGLUM01G45160 transcript:OGLUM01G45160.1 description:""
Sequence
MVELIKVPKIEQEEGNADSHGKEKADVVHEEKTEKVKRRRKRVSDPQRKKACVDCTKRCI
RIHGMASSSSEKARPTPTLPSFFKIMVGYFSENMDIPLPFARTITDMTGSNVYLEDAYGL
RWRVRLYLHDDVLSFGHGWKNFVLDHDISVGEFLVFRQIARSVFTVQIFAISACERIHLC
ERNKRQSRKRKPGRKTGYPANNQMVKVSSKDVVKRRKKQRTDEQIYDLDPRQHDMPVRVC
IDSGSELRCSESSVKELDAAPDKSHAVVQVPATECNADPSYNAAGMKTIKNLEAIGASSS
TKDVTWDANKSEDYPSFSYPESSNVMTADKESERSHQDRPMQLYCELGLEDGNAETDNCE
NSNVLENAELRTPLAMMDLNEVGIDDIFLSADIYEFDSDFCSPEAFSVDVNTEGLVANGR
TPGDCFGMPETSRCLENKQMTDVPRTSTDDGSIAVHGIDINALPSNTYPDIGQGNTYPDI
DAAPDDCKKDKDVLHSECNKVAQKAHSSVKQDITKDGPRQIAAEIMSSGPKTCELTYVRK
NSVQPGTSSVSQWNNSKGQESGGTKSCVVLAVAANSKKFCITIPPPDQTWLELPRRLPVL
PRTKKQARKILILKDPSMRLWPVLYQCTPKFNGFIAGWADISRENNLREGDTCEFELCSN
SELSFQVLVPNLQ
Download sequence
Identical sequences A0A0D9YIU6
OGLUM01G45160.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]