SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for OGLUM01G48150.1 from Oryza glumaepatula 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OGLUM01G48150.1
Domain Number 1 Region: 258-389
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.63e-19
Family Ankyrin repeat 0.00097
Further Details:      
 
Domain Number 2 Region: 9-53,98-183
Classification Level Classification E-value
Superfamily POZ domain 2.75e-17
Family BTB/POZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OGLUM01G48150.1
Sequence length 510
Comment pep:novel chromosome:ALNU02000000:1:44908880:44911640:-1 gene:OGLUM01G48150 transcript:OGLUM01G48150.1 description:""
Sequence
MEETLKSLSMDYLNLLINGQAFSDVTFSVEGRLVHAHRCILAARSLFFRKFFCGAAADQA
AAPPGALLLDHLSPRSPSGGASASSPRGAGGSAAAAAAAAAATPGAVIPVSSVSYEVFLL
LLQFLYSGQVSLVPQKGEPRPGCGERGCWHTHCAAAVDLALDTLAAARSFGVEELALLTQ
KQLAGMVEKASIEDVMKVLMASRKQDLHQLWTTCSHLVAKSGLPPEVLAKHLPIDVVAKI
DELRLKSMSRRSPFLSHHHHHHPHAAAAGIEASSAAELDDHHKIRRMRRALDSSDVELVK
LMVMGEGLNLDDALALHYAVENCSREVVKALLELGAADVNHPAGPAGKTPLHVAAEMVCP
DMVAVLLDHHADPNVRTVDGVTPLDILRTLTSDFLFKGAVPGLTHIEPNKLRLCLELVQS
AAMVMSREDAQTAAVNAAPIYGESPGGGGGGGVYNASGTSSSMVNLSLDNRMVYLNLGMD
AQFGKMNDGGDGDDGGSRGPSSLFSPHGFP
Download sequence
Identical sequences A0A0D9YK06
OGLUM01G48150.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]